PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G291200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 344aa    MW: 38241.2 Da    PI: 6.6817
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G291200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.45.9e-092683061755
                         HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                         e+ +k +yps++++  LA+++gL+ +q+ +WF N+R ++
  Brast02G291200.1.p 268 EMHYKWPYPSESQKVALAESTGLDLKQINNWFINQRKRH 306
                         5566789*****************************885 PP

2ELK37.26.3e-13226247122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELKh+Ll+KYsgyL+sLkqE+s
  Brast02G291200.1.p 226 ELKHHLLKKYSGYLSSLKQELS 247
                         9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.3E-2186130IPR005540KNOX1
PfamPF037904.1E-2187128IPR005540KNOX1
SMARTSM012565.6E-28137188IPR005541KNOX2
PfamPF037916.8E-23143186IPR005541KNOX2
SMARTSM01188780146166IPR005539ELK domain
PfamPF037897.7E-10226247IPR005539ELK domain
SMARTSM011884.9E-7226247IPR005539ELK domain
PROSITE profilePS5121311.331226246IPR005539ELK domain
PROSITE profilePS5007112.665246309IPR001356Homeobox domain
SuperFamilySSF466891.92E-19247323IPR009057Homeodomain-like
SMARTSM003896.1E-13248313IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.2E-28251310IPR009057Homeodomain-like
CDDcd000861.32E-12258310No hitNo description
PfamPF059201.5E-16266305IPR008422Homeobox KN domain
PROSITE patternPS000270284307IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MEDITAHHFG LGASGHGHHP WSSSSLSAVV APPPQQQQQQ GGYLAHSPLS LNTAAPSHGN  60
PVLQLANGSL LDACAKAKEP YAADVEAIKA KIVSHPIYPS LLAAYLDCLK VGAPPEVSER  120
MSAVARDLEL RQRAGLGGLA AATEPELDQF MEAYSEMLVK YREELTRPLQ EAMEFLRRVE  180
SQLNSLSING RSLRNILSSV SSEEDQEGSG GETELPEIDA HGVDQELKHH LLKKYSGYLS  240
SLKQELSKKK KKGKLPKDAR QQLLSWWEMH YKWPYPSESQ KVALAESTGL DLKQINNWFI  300
NQRKRHWKPS DEMQFVMMDG YHPPNAFYMD GHFINDGGLY RFG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2244990.0AF224499.1 Triticum aestivum KNOTTED-1-like homeobox protein b (knox1b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230586.10.0PREDICTED: homeobox protein KNOX3
SwissprotQ434840.0KNOX3_HORVU; Homeobox protein KNOX3
TrEMBLA0A0Q3N9P20.0A0A0Q3N9P2_BRADI; Uncharacterized protein
STRINGBRADI1G10047.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98863145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.19e-92KNOTTED-like from Arabidopsis thaliana